Antigen
Antigen Name
DNMT3A_11-A002
Antigen Sequence
MHHHHHHHHHHDLGTENLYFQSMGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEESSKGGYGLNDIFEAQKIEWHE
Construct Sequence
N/A
Antigen Start
N/A
Antigen Stop
N/A
Uniprot Start
N/A
Uniprot Stop
N/A
Antigen (Cont..)
Tag N Terminus
N/A
Tag C Terminus
N/A
N Tag Start
N/A
N Tag Stop
N/A
C Tag Start
N/A
C Tag Stop
N/A
Biotinylated
N/A
Protein
Source Lab
SGC
Protein Uniprot ID
Q9Y6K1 || UniProt
Species
Human
Category
High-priority uDBP
Category Protein Comments
EMSA-positive, ChIP-PCR-positive uDBP

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data