Antigen
Antigen Name
HR9658A.002
Antigen Sequence
GGRNISVETASLDVYAKYVLRSICQQEWVGERCLKSLCEDSNDLQDPVLSSAQAQRLMQLICYPHRLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAET
Construct Sequence
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKSLCEDSNDLQDPVLSSAQAQRLMQLICYPHRLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETG
Antigen Start
33
Antigen Stop
165
Uniprot Start
1265
Uniprot Stop
1397
Antigen (Cont..)
Tag N Terminus
AviTag - 6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
32
C Tag Start
0
C Tag Stop
0
Biotinylated
N
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q93074 || UniProt
Species
Human
Category
Chromatin associated proteins-JHMI
Category Protein Comments
Chromatin-associated protein

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data