Antigen
Antigen Name
HR8342A.002
Antigen Sequence
RYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCG
Construct Sequence
MGHHHHHHSHMRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCG
Antigen Start
12
Antigen Stop
66
Uniprot Start
527
Uniprot Stop
581
Antigen (Cont..)
Tag N Terminus
6xHis-Tag
Tag C Terminus
None
N Tag Start
1
N Tag Stop
11
C Tag Start
0
C Tag Stop
0
Biotinylated
N
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q66K89 || UniProt
Species
Human
Category
A grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data