Antigen
Antigen Name
HR8010A.001
Antigen Sequence
PFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDS
Construct Sequence
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASCVH
Antigen Start
33
Antigen Stop
113
Uniprot Start
55
Uniprot Stop
135
Antigen (Cont..)
Tag N Terminus
AviTag - 6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
32
C Tag Start
N/A
C Tag Stop
N/A
Biotinylated
N/A
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q7Z7L9 || UniProt
Species
Human
Category
A grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data