Antigen
Antigen Name
HR7903A.003
Antigen Sequence
N/A
Construct Sequence
CHHHHHHGSGSGSENLYFQSHMHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQD
Antigen Start
591
Antigen Stop
687
Uniprot Start
21
Uniprot Stop
117
Antigen (Cont..)
Tag N Terminus
6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
590
C Tag Start
0
C Tag Stop
0
Biotinylated
N
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q9Y2K1 || UniProt
Species
Human
Category
B grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data