Antigen
Antigen Name
HR7828A.004
Antigen Sequence
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY
Construct Sequence
MSGLNDIFEAQKIEWHEHHHHHHENLYFQSHMKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY
Antigen Start
33
Antigen Stop
103
Uniprot Start
8
Uniprot Stop
78
Antigen (Cont..)
Tag N Terminus
AviTag - 6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
32
C Tag Start
0
C Tag Stop
0
Biotinylated
Y
Protein
Source Lab
Rutgers
Protein Uniprot ID
P09429 || UniProt
Species
Human
Category
Other potential TF
Category Protein Comments
Known TF activity

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data