Antigen
Antigen Name
HR6995B.005
Antigen Sequence
N/A
Construct Sequence
CHHHHHHGSGSGSENLYFQSHMFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
Antigen Start
591
Antigen Stop
704
Uniprot Start
633
Uniprot Stop
746
Antigen (Cont..)
Tag N Terminus
6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
590
C Tag Start
0
C Tag Stop
0
Biotinylated
N
Protein
Source Lab
Rutgers
Protein Uniprot ID
P55201 || UniProt
Species
Human
Category
Chromatin associated proteins-RAN
Category Protein Comments
Chromatin-associated protein

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data