Antigen
Antigen Name
HR6973A.002
Antigen Sequence
IHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAI
Construct Sequence
MDVEAWLDERVPLVETHHHHHHENLYFQSHMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAI
Antigen Start
32
Antigen Stop
89
Uniprot Start
486
Uniprot Stop
543
Antigen (Cont..)
Tag N Terminus
NanoTag - 6xHis-Tag - TEV
Tag C Terminus
None
N Tag Start
1
N Tag Stop
31
C Tag Start
0
C Tag Stop
0
Biotinylated
N
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q96BD5 || UniProt
Species
Human
Category
Annotated high-confidence TF
Category Protein Comments
Rutgers added

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data