Antigen
Antigen Name
HR6006E.006
Antigen Sequence
MTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKK
Construct Sequence
MTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKTLEHHHHHH
Antigen Start
1
Antigen Stop
131
Uniprot Start
311
Uniprot Stop
441
Antigen (Cont..)
Tag N Terminus
None
Tag C Terminus
6xHis-Tag
N Tag Start
N/A
N Tag Stop
N/A
C Tag Start
132
C Tag Stop
139
Biotinylated
N/A
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q9P2R6 || UniProt
Species
Human
Category
B grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data