Antigen
Antigen Name
HR3023C.031
Antigen Sequence
N/A
Construct Sequence
SHMAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVS
Antigen Start
417
Antigen Stop
530
Uniprot Start
10
Uniprot Stop
123
Antigen (Cont..)
Tag N Terminus
None
Tag C Terminus
None
N Tag Start
1
N Tag Stop
416
C Tag Start
0
C Tag Stop
0
Biotinylated
Y
Protein
Source Lab
Rutgers
Protein Uniprot ID
Q00613 || UniProt
Species
Human
Category
A grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data