Skip to main content
Antigen
Antigen Name
JHU17776
Antigen Sequence
MTMFKEAVTFKDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQREEKFWIMETATQREGNSGGKIQTELESVPETGPHEEWSCQQIWEQTASELTRPQDSISSSQFSTQGDVPSQVDAGLSIIHIGETPSEHGKCKKFFSDVSILDLHQQLHSGKISHTCNEYRKRFCYSSALCLHQKVHMGEKRYKCDVCSKAFSQNSQLQTHQRIHTGEKPFKCEQCGKSFSRRSGMYVHCKLHTGEKPHICEECGKAFIHNSQLREHQRIHTGEKPFKCYICGKSFHSRSNLNRHSMVHMQEKSFRCDTCSNSFGQRSALNSHCMDHTKEKLYKCEECGRSFTCRQDLCKHQMDHTGDKPYNCNVCGKGFRWSSCLSRHQRVHNGETTFKCDGCGKRFYMNSQGHSHQRAYREEELYKCQKCGKGYISKFNLDLHQRVHTGERPYNCKECGKSFRWASGILRHKRLHTGEKPFKCEECGKRFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTHQRLHSREKLFQCEDCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI
Construct Sequence
N/A
Antigen Start
N/A
Antigen Stop
N/A
Uniprot Start
N/A
Uniprot Stop
N/A
Antigen (Cont..)
Tag N Terminus
N/A
Tag C Terminus
N/A
N Tag Start
N/A
N Tag Stop
N/A
C Tag Start
N/A
C Tag Stop
N/A
Biotinylated
N/A
Protein
Source Lab
JHU/CDI
Protein Uniprot ID
Q2VY69 || UniProt
Species
Human
Category
B grade TF
Category Protein Comments
Annotated high-confidence TF

HGNC Name
Antigen
Antibody Name
Antibody Source
Type
IsoType
Source Taxon
Expression Taxon
Data Files
Passed Validations
Distributors
HGNC Name
Protein Uniprot ID
Antigen
Antigen Source
Count of Antibodies
Distributors
HGNC Name
Protein Uniprot ID
Count of Antigens
Count of Antibodies
HGNC Name
Protein Uniprot ID
Antibody Name
Type
Validation Data
Result Status
Lab Performing Trial
Validation Type Data